PC4L1_HUMAN   A6NKN8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NKN8

Recommended name:Purkinje cell protein 4-like protein 1

EC number:

Alternative names:(PCP4-like protein 1)

Cleaved into:

GeneID:654790

Gene names  (primary ):PCP4L1

Gene names  (synonym ):IQM1

Gene names  (ORF ):

Length:68

Mass:7476

Sequence:MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:PCP4 family


   💬 WhatsApp