HIKES_HUMAN Q53FT3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q53FT3
Recommended name：Protein Hikeshi
EC number：
Alternative names：
Cleaved into：
GeneID：51501
Gene names (primary )：HIKESHI
Gene names (synonym )：C11orf73
Gene names (ORF )：HSPC138 HSPC179 HSPC248
Length：197
Mass：21628
Sequence：MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT
Tissue specificity：
Induction：Following heat-shock treatment. {ECO:0000269|PubMed:22541429}.
Developmental stage：
Protein families：OPI10 family