GBG7_MOUSE   Q61016


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61016

Recommended name:Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Gng7

Gene names  (synonym ):Gngt7

Gene names  (ORF ):

Length:68

Mass:7480

Sequence:MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPFKDKKPCIIL

Tissue specificity:Brain. Found in the hippocampus, striatum, midbrain and cortex. {ECO:0000269|PubMed:12488442}.

Induction:

Developmental stage:

Protein families:G protein gamma family


   💬 WhatsApp