D19P2_HUMAN   Q6ZN68


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6ZN68

Recommended name:Putative C-mannosyltransferase DPY19L2P2

EC number:EC:2.4.1.-

Alternative names:(Dpy-19-like protein 2 pseudogene 2) (Protein dpy-19 homolog 2-like 2)

Cleaved into:

GeneID:

Gene names  (primary ):DPY19L2P2

Gene names  (synonym ):

Gene names  (ORF ):

Length:376

Mass:43060

Sequence:MADSRRVIIASWYRTFMGIVNLFGLETKTCWNVTRIEPLNEVQSCEGLRDPACFYVGVIFILNGLMMGLFFIYGTYLSGTELGGLITVLCFFFNHGEATCVMWTPPLRESFSYPFLVLQMYVLTLILRTSSNDRRPFIALCLSNVAFMLPWQFAQFILFTQIASLFPMYVVGYIEPSKFQKIIYMNMISVTLSFILMFGNSMYLSSYYSSSLLMTWAIILKRNEIQKLGVSKLNCWLIQGSAWWCGTIILKFLTSKILGVSDHICLSDLIAAGILRYTDFDTLKYTCSPEFDFMEKATLLIYTKTLLLPVVMVITCFIFKKTVGDISRVLATNVYLRCCLCRCHAYNGKCQAVYTSSHCESSTLRRCRLEAWLQHA

Tissue specificity:Fibroblast, lung, lymphoblast, spleen and testis. {ECO:0000269|PubMed:16526957}.

Induction:

Developmental stage:

Protein families:Dpy-19 family


   💬 WhatsApp