PRDX1_HUMAN Q06830
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06830
Recommended name:Peroxiredoxin-1
EC number:EC:1.11.1.24
Alternative names:(Natural killer cell-enhancing factor A) (NKEF-A) (Proliferation-associated gene protein) (PAG) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Thioredoxin-dependent peroxiredoxin 1)
Cleaved into:
GeneID:5052
Gene names (primary ):PRDX1
Gene names (synonym ):PAGA PAGB TDPX2
Gene names (ORF ):
Length:199
Mass:22110
Sequence:MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Tissue specificity:
Induction:Constitutively expressed in most human cells; is induced to higher levels upon serum stimulation in untransformed and transformed cells.
Developmental stage:
Protein families:Peroxiredoxin family, AhpC/Prx1 subfamily