HXC11_MOUSE P31313
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31313
Recommended name：Homeobox protein Hox-C11
EC number：
Alternative names：(Homeobox protein Hox-3.7)
Cleaved into：
GeneID：109663
Gene names (primary )：Hoxc11
Gene names (synonym )：Hox-3.7 Hoxc-11
Gene names (ORF )：
Length：304
Mass：33708
Sequence：MFNSVNLGNFCSPSRKERGADFGERGSCTSNLYLPSCTYYVPEFSTVSSFLPQAPSRQISYPYSAQVPPVREVSYGLEPSGKWHHRNSYSSCYAAADELMHRECLPPSTVTEILMKNEGSYGGHHHPSAPHAAPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDAPAEPPCSGKGEAKGEPEAPPASGLASRAEAGAEAEAEEENTNPSSSGSSHSATKEPAKGAAPNAPRTRKKRCPYSKFQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKLSRDRLQYFSGNPLL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Abd-B homeobox family