PORED_HUMAN Q9H8P0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H8P0
Recommended name：Polyprenol reductase
EC number：EC:1.3.1.94
Alternative names：(3-oxo-5-alpha-steroid 4-dehydrogenase 3) (Steroid 5-alpha-reductase 2-like) (Steroid 5-alpha-reductase 3) (S5AR 3) (SR type 3)
Cleaved into：
GeneID：79644
Gene names (primary )：SRD5A3
Gene names (synonym )：SRD5A2L
Gene names (ORF )：
Length：318
Mass：36521
Sequence：MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF
Tissue specificity：Expressed in preadipocytes (at protein level) (PubMed:26855069). Overexpressed in hormone-refractory prostate cancers (HRPC). Almost no or little expression in normal adult organs. {ECO:0000269|PubMed:17986282, ECO:0000269|PubMed:26855069}.
Induction：
Developmental stage：
Protein families：Steroid 5-alpha reductase family, Polyprenol reductase subfamily