TISR_HUMAN   Q9Y5M6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y5M6

Recommended name:Oculomedin

EC number:

Alternative names:(Trabecular meshwork-inducible stretch response protein) (TISR)

Cleaved into:

GeneID:

Gene names  (primary ):OCLM

Gene names  (synonym ):

Gene names  (ORF ):

Length:44

Mass:5321

Sequence:MGMYPPLLLKIYLSRHISILFYLKILYKSGIIWLSWYSFILLVL

Tissue specificity:Expressed in eye trabeculum; also expressed in retina.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp