SCRG1_HUMAN   O75711


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75711

Recommended name:Scrapie-responsive protein 1

EC number:

Alternative names:(Scrapie-responsive gene 1 protein) (ScRG-1)

Cleaved into:

GeneID:11341

Gene names  (primary ):SCRG1

Gene names  (synonym ):

Gene names  (ORF ):UNQ390/PRO725

Length:98

Mass:11081

Sequence:MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Tissue specificity:Expressed abundantly in the central nervous system of adult, but not at all in fetal brain. High levels of SCRG1 transcripts are also observed in testis and aorta.

Induction:

Developmental stage:

Protein families:SCRG1 family


   💬 WhatsApp