LOX15_MOUSE P39654
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P39654
Recommended name：Polyunsaturated fatty acid lipoxygenase ALOX15
EC number：EC 1.13.11.31
Alternative names：(12/15-lipoxygenase) (12/15-LO) (Arachidonate 12-lipoxygenase, leukocyte-type) (12-LOX) (L-12LO) (Arachidonate 15-lipoxygenase) (15-LOX) (Arachidonate omega-6 lipoxygenase) (Hepoxilin A3 synthase Alox15) (Linoleate 13S-lipoxygenase) (EC 1.13.11.12)
Cleaved into：
GeneID：11687
Gene names (primary )：Alox15
Gene names (synonym )：Alox12l
Gene names (ORF )：
Length：663
Mass：75445
Sequence：MGVYRIRVSTGDSVYAGSNNEVYLWLIGQHGEASLGKLFRPCRNSEAEFKVDVSEYLGPLLFVRVQKWHYLKEDAWFCNWISVKGPGDQGSEYTFPCYRWVQGTSILNLPEGTGCTVVEDSQGLFRNHREEELEERRSLYRWGNWKDGTILNVAATSISDLPVDQRFREDKRLEFEASQVLGTMDTVINFPKNTVTCWKSLDDFNYVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPMVLKRSTCLPARLVFPPGMEKLQAQLDEELKKGTLFEADFFLLDGIKANVILCSQQYLAAPLVMLKLQPDGQLLPIAIQLELPKTGSTPPPIFTPLDPPMDWLLAKCWVRSSDLQLHELQAHLLRGHLVAEVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKVMSTGGGGHLDLLKQAGAFLTYSSLCPPDDLAERGLLDIDTCFYAKDALQLWQVMNRYVVGMFDLYYKTDQAVQDDYELQSWCQEITEIGLQGAQDRGFPTSLQSRAQACHFITMCIFTCTAQHSSIHLGQLDWFYWVPNAPCTMRLPPPKTKDATMEKLMATLPNPNQSTLQINVVWLLGRRQAVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSLVENSVAI
Tissue specificity：Found in pituitary and pineal glands as well as leukocytes, kidney, aorta, small intestine and cornea (PubMed:15708862, PubMed:22503541, PubMed:8188678). Also expressed by resident peritoneal macrophages (at protein level) (PubMed:8798642). {ECO:0000269|PubMed:15708862, ECO:0000269|PubMed:22503541, ECO:0000269|PubMed:8188678, ECO:0000269|PubMed:8798642}.
Induction：Up-regulated in response to endoplasmic reticulum stress (at protein level). {ECO:0000269|PubMed:22215650}.
Developmental stage：
Protein families：Lipoxygenase family