PAX8_MOUSE   Q00288


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00288

Recommended name:Paired box protein Pax-8

EC number:

Alternative names:

Cleaved into:

GeneID:18510

Gene names  (primary ):Pax8

Gene names  (synonym ):Pax-8

Gene names  (ORF ):

Length:457

Mass:48793

Sequence:MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGNDNKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDTFSQHHLEALECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSALDDGKATLTSSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYSHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTSATAFDHL

Tissue specificity:Expressed in the developing excretory system and the thyroid gland.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp