PA1B2_RAT   O35264


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35264

Recommended name:Platelet-activating factor acetylhydrolase IB subunit alpha2 Curated

EC number:EC:3.1.1.47

Alternative names:PAF acetylhydrolase 30 kDa subunit (PAF-AH 30 kDa subunit) PAF-AH subunit beta (PAFAH subunit beta) Platelet-activating factor acetylhydrolase alpha 2 subunit (PAF-AH alpha 2)

Cleaved into:

GeneID:64189

Gene names  (primary ):Pafah1b2

Gene names  (synonym ):Pafahb

Gene names  (ORF ):

Length:229

Mass:25,581

Sequence:MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDIDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Tissue specificity:Expressed in heart, brain, spleen, lung, liver, kidney and testis. Not expressed in skeletal muscle. Expressed in fetal as heterodimer and adult brain as homodimer. In neural cells, expressed in granule cells, astroglial cells, and oligodendrocytes (PubMed:9660828). 1

Induction:

Developmental stage:During the embryonic stages, high expressed in the brain, spinal cord, sensory ganglia (dorsal root and trigeminal ganglia), and thymus. In brain found throughout the ventricular and marginal zones. 1

Protein families:


   💬 WhatsApp