TIM21_HUMAN   Q9BVV7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BVV7

Recommended name:Mitochondrial import inner membrane translocase subunit Tim21

EC number:

Alternative names:(TIM21-like protein, mitochondrial)

Cleaved into:

GeneID:29090

Gene names  (primary ):TIMM21

Gene names  (synonym ):C18orf55 TIM21

Gene names  (ORF ):HSPC154

Length:248

Mass:28202

Sequence:MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD

Tissue specificity:

Induction:

Developmental stage:

Protein families:TIM21 family


   💬 WhatsApp