8ODP_RAT P53369
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P53369
Recommended name:Oxidized purine nucleoside triphosphate hydrolase Curated
EC number:EC:3.6.1.56
Alternative names:2-hydroxy-dATP diphosphatase 7,8-dihydro-8-oxoguanine triphosphatase 8-oxo-dGTPase Methylated purine nucleoside triphosphate hydrolase By Similarity (EC:3.6.1.- By Similarity) . EC:3.6.1.- (UniProtKB | ENZYME | Rhea) By Similarity Nucleoside diphosphate-linked moiety X motif 1 (Nudix motif 1)
Cleaved into:
GeneID:117260
Gene names (primary ):Nudt1
Gene names (synonym ):Mth1
Gene names (ORF ):
Length:156
Mass:18,018
Sequence:MSTSRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGAKRELLEESGLRVDTLHKVGHISFEFVGSPELMDVHIFSTDHVHGTPTESEEMRPQWFQLDQIPFADMWPDDSYWFPLLLQKKKFCGHFKFHGQDTILSYSLREVDEF
Tissue specificity:Expressed in liver in hepatocytes and weakly in Kupffer's cells. Expression detected in testes in primary and secondary spermatocytes and interstitial cells. High expression levels detected in the inner cortex of kidney, with lower levels detected in the tubules of the outer cortex, medulla, renal pelvis and glomeruli (at protein level). Expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis. 2 s
Induction:
Developmental stage:
Protein families: