GPS2_HUMAN Q13227
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13227
Recommended name：G protein pathway suppressor 2
EC number：
Alternative names：(GPS-2)
Cleaved into：
GeneID：2874
Gene names (primary )：GPS2
Gene names (synonym )：
Gene names (ORF )：
Length：327
Mass：36689
Sequence：MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Tissue specificity：Widely expressed. {ECO:0000269|PubMed:8943324}.
Induction：Down-regulated in liposarcoma (PubMed:27460081). Down-regulated in macrophages of patients with adipose tissue inflammation and type-2 diabetes (PubMed:27270589). {ECO:0000269|PubMed:27270589, ECO:0000269|PubMed:27460081}.
Developmental stage：
Protein families：