OCC1_HUMAN Q8TAD7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TAD7
Recommended name：Overexpressed in colon carcinoma 1 protein
EC number：
Alternative names：(OCC-1) (AGD3)
Cleaved into：
GeneID：387882
Gene names (primary )：OCC1
Gene names (synonym )：C12orf75
Gene names (ORF )：
Length：63
Mass：6407
Sequence：MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN
Tissue specificity：High expression in placenta, skeletal muscle, kidney and pancreas tissues. Absent or very faint expression in heart, brain, lung and liver. Expressed during adipogenic differentiation of mesenchymal stem cells (at protein level). {ECO:0000269|PubMed:11890990, ECO:0000269|PubMed:19531736}.
Induction：
Developmental stage：
Protein families：OCC1 family