HSF2B_HUMAN   O75031


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75031

Recommended name:Heat shock factor 2-binding protein

EC number:

Alternative names:

Cleaved into:

GeneID:11077

Gene names  (primary ):HSF2BP

Gene names  (synonym ):MEILB2

Gene names  (ORF ):

Length:334

Mass:37645

Sequence:MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV

Tissue specificity:Testis specific. Overexpressed in some tumors (PubMed:31242413). {ECO:0000269|PubMed:31242413, ECO:0000269|PubMed:9651507}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp