DLX4_MOUSE P70436
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70436
Recommended name：Homeobox protein DLX-4
EC number：
Alternative names：(Homeobox protein DLX-7)
Cleaved into：
GeneID：13394
Gene names (primary )：Dlx4
Gene names (synonym )：Dlx7
Gene names (ORF )：
Length：240
Mass：26579
Sequence：MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHFGAWYQHRSPDVLALPQMM
Tissue specificity：Branchial arches, molar and incisor teeth and limbs.
Induction：
Developmental stage：Expressed in the mesenchyme of the anterior palate at 12.5 dpc, prior to the time of palate closure. Expression levels decrease at later time periods after palate closure. {ECO:0000269|PubMed:25954033}.
Protein families：Distal-less homeobox family