RETNB_MOUSE Q99P86
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99P86
Recommended name：Resistin-like beta
EC number：
Alternative names：(Cysteine-rich secreted protein A12-beta) (Cysteine-rich secreted protein FIZZ2) (RELMbeta)
Cleaved into：
GeneID：57263
Gene names (primary )：Retnlb
Gene names (synonym )：Fizz2
Gene names (ORF )：
Length：105
Mass：11278
Sequence：MKPTLCFLFILVSLFPLIVPGNAQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
Tissue specificity：Strongly expressed in colon, and at lower levels in ileum (PubMed:15834545). In colon, found throughout the crypt and surface epithelium and in goblet cells (at protein level) (PubMed:15834545). Specific to the gastrointestinal tract; not detected in other tissues tested (PubMed:11209052, PubMed:15834545). {ECO:0000269|PubMed:11209052, ECO:0000269|PubMed:15834545}.
Induction：Up-regulated in colon in response to a high-fat diet. Also up-regulated in obese mice mutant for the leptin receptor LEPR (db/db genotype). {ECO:0000269|PubMed:15834545}.
Developmental stage：
Protein families：Resistin/FIZZ family