LPP60_RAT O88202
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88202
Recommended name：60 kDa lysophospholipase
EC number：EC:3.1.1.5
Alternative names：Lysophospholipase-transacylase 3 Publications
Cleaved into：
GeneID：246266
Gene names (primary )：Aspg
Gene names (synonym )：
Gene names (ORF )：
Length：564
Mass：60,795
Sequence：MARATGPEQRLLAIYTGGTIGMRSEGGVLVPGRGLAAVLRTLHMLHDEEYARAHSLPEDTLVLPPASSDQRIIYKVLECQPLFDSSDMTITEWVQIAQTIERHYTQYQGFVVIHGTDTMAFAASVLSFMLENLQKPVILTGAQVPIHELWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKASWKSHLVVHSNMEPDVGLLRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGPTKPDLIQELRAAAERGLIIVNCTHCLQGAVTSDYAPGMAMAGAGIISGFDMTSEAALAKLSYVLGQPGLSLSDRKKLLAKDLRGEMTLPTTDDLLGDDMLGCRATWLLSMNGSQDADAMKDVLLPGLALAAAHAGDLDTLQAFVELGRDLNLKDYSGQTPLHVAARRGHASVVAMLLQKGVDVDACNEDGQSPLLLAVRGRHQSVIRLLRAAGAHLSPQELEDVGTELCRLASRADSEGLRAWWQAGADLGQPDYDGHCALQVAEAAGNADVVALLQSLEDRVSAQPQPH
Tissue specificity：Expressed at high levels in liver and kidney and at a low level in stomach. Barely detectable in lung, heart, spleen and brain. 1
Induction：
Developmental stage：
Protein families：