PPR1C_MOUSE   Q8BKK4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BKK4

Recommended name:Protein phosphatase 1 regulatory subunit 1C

EC number:

Alternative names:

Cleaved into:

GeneID:75276

Gene names  (primary ):Ppp1r1c

Gene names  (synonym ):

Gene names  (ORF ):

Length:108

Mass:12303

Sequence:MEPNSPKKIQFAVPLFQSQIAPEAAEQIRKRRPTPASLVILNEHNSPEIDEKRVTNTQESQNASPKQRKQSVYTPPAMKGVKHLKDQNGSAFPEEEESASEREEKWNH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Protein phosphatase inhibitor 1 family


   💬 WhatsApp