MILR1_RAT   Q62875


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62875

Recommended name:Allergin-1

EC number:

Alternative names:

Cleaved into:

GeneID:59105

Gene names  (primary ):Milr1

Gene names  (synonym ):Mca32

Gene names  (ORF ):

Length:248

Mass:27,459

Sequence:MGDDDTPVCLSVASCKGVSCWLDKLLLWALTLSITLRNTAVDCRRVDRNGLLSPNLNSSMSVVRMGQNVSLSCSSKNTSIDITYSLFLGKRYLESKRRRGGAVDFHLRISNANESGPYKCKVNDSNSSKYSQNFNFTIIQDESCSSCLLSLLLPGVLLGLILPGLAFLIYLKYKKGCTGKTLKENESKGSGDAPTQGELYANICETQKGSEQLQEIHYTTPVFKEVAPTEQEGLEDRKDDYIYSELTY

Tissue specificity:Mast cell-specific. Expressed in primary and transformed mast cells. 1

Induction:

Developmental stage:Up-regulated in response to mast cell activation. 1

Protein families:


   💬 WhatsApp