MILR1_RAT Q62875
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62875
Recommended name:Allergin-1
EC number:
Alternative names:
Cleaved into:
GeneID:59105
Gene names (primary ):Milr1
Gene names (synonym ):Mca32
Gene names (ORF ):
Length:248
Mass:27,459
Sequence:MGDDDTPVCLSVASCKGVSCWLDKLLLWALTLSITLRNTAVDCRRVDRNGLLSPNLNSSMSVVRMGQNVSLSCSSKNTSIDITYSLFLGKRYLESKRRRGGAVDFHLRISNANESGPYKCKVNDSNSSKYSQNFNFTIIQDESCSSCLLSLLLPGVLLGLILPGLAFLIYLKYKKGCTGKTLKENESKGSGDAPTQGELYANICETQKGSEQLQEIHYTTPVFKEVAPTEQEGLEDRKDDYIYSELTY
Tissue specificity:Mast cell-specific. Expressed in primary and transformed mast cells. 1
Induction:
Developmental stage:Up-regulated in response to mast cell activation. 1
Protein families: