KAD1_MOUSE   Q9R0Y5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0Y5

Recommended name:Adenylate kinase isoenzyme 1

EC number:EC 2.7.4.3

Alternative names:(AK 1) (ATP-AMP transphosphorylase 1) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) (Myokinase)

Cleaved into:

GeneID:11636

Gene names  (primary ):Ak1

Gene names  (synonym ):

Gene names  (ORF ):

Length:194

Mass:21540

Sequence:MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK

Tissue specificity:

Induction:

Developmental stage:Up-regulated during late spermiogenesis, when the flagellum is being assembled. {ECO:0000269|PubMed:16790685}.

Protein families:Adenylate kinase family, AK1 subfamily


   💬 WhatsApp