PTTG_HUMAN   P53801


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P53801

Recommended name:Pituitary tumor-transforming gene 1 protein-interacting protein

EC number:

Alternative names:(Pituitary tumor-transforming gene protein-binding factor) (PBF) (PTTG-binding factor)

Cleaved into:

GeneID:754

Gene names  (primary ):PTTG1IP

Gene names  (synonym ):C21orf1 C21orf3

Gene names  (ORF ):

Length:180

Mass:20324

Sequence:MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN

Tissue specificity:Ubiquitous.

Induction:By transcription factor RUNX2. {ECO:0000269|PubMed:15190888}.

Developmental stage:

Protein families:


   💬 WhatsApp