GPR12_RAT P30951
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30951
Recommended name：G-protein coupled receptor 12
EC number：
Alternative names：
Cleaved into：
GeneID：80840
Gene names (primary )：Gpr12
Gene names (synonym )：Gpcr12
Gene names (ORF )：
Length：334
Mass：36,704
Sequence：MNEDPKVNLSGLPRDCIEAGTPENISAAVPSQGSVVESEPELVVNPWDIVLCSSGTLICCENAVVVLIIFHSPSLRAPMFLLIGSLALADLLAGLGLIINFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSTCLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSISFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGISTLALILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPNTLSQRARSPSDV
Tissue specificity：Expressed in the brain, pituitary gland and testis. 2 s
Induction：
Developmental stage：
Protein families：