CISD2_MOUSE Q9CQB5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQB5
Recommended name：CDGSH iron-sulfur domain-containing protein 2
EC number：
Alternative names：(MitoNEET-related 1 protein) (Miner1) (Nervous system overexpressed protein 70)
Cleaved into：
GeneID：67006
Gene names (primary )：Cisd2
Gene names (synonym )：Cdgsh2 Noxp70 Zcd2
Gene names (ORF )：
Length：135
Mass：15242
Sequence：MVLDSVARIVKVQLPAYLKQLPVPDSITGFARLTVSDWLRLLPFLGVLALLGYLAVRPFFPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Tissue specificity：Brain. {ECO:0000269|PubMed:17029606}.
Induction：Expression decreases in an age-dependent manner. {ECO:0000269|PubMed:19451219}.
Developmental stage：
Protein families：CISD protein family, CISD2 subfamily