RT18C_HUMAN Q9Y3D5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y3D5
Recommended name：28S ribosomal protein S18c, mitochondrial
EC number：
Alternative names：(MRP-S18-c) (Mrps18-c) (S18mt-c) (28S ribosomal protein S18-1, mitochondrial) (MRP-S18-1) (Mitochondrial small ribosomal subunit protein bS18c) (Mitochondrial small ribosomal subunit protein bS18m)
Cleaved into：
GeneID：51023
Gene names (primary )：MRPS18C
Gene names (synonym )：
Gene names (ORF )：CGI-134
Length：142
Mass：15850
Sequence：MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE
Tissue specificity：
Induction：
Developmental stage：
Protein families：Bacterial ribosomal protein bS18 family