VA0D1_MOUSE P51863
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51863
Recommended name：V-type proton ATPase subunit d 1
EC number：
Alternative names：(V-ATPase subunit d 1) (P39) (Physophilin) (V-ATPase 40 kDa accessory protein) (V-ATPase AC39 subunit) (Vacuolar proton pump subunit d 1)
Cleaved into：
GeneID：11972
Gene names (primary )：Atp6v0d1
Gene names (synonym )：Atp6d
Gene names (ORF )：
Length：351
Mass：40301
Sequence：MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Tissue specificity：Ubiquitous. {ECO:0000269|PubMed:12527205, ECO:0000269|PubMed:12963731}.
Induction：
Developmental stage：Expressed throughout early development. {ECO:0000269|PubMed:12963731}.
Protein families：V-ATPase V0D/AC39 subunit family