CNIH2_MOUSE O35089
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35089
Recommended name：Protein cornichon homolog 2
EC number：
Alternative names：(CNIH-2) (Cornichon family AMPA receptor auxiliary protein 2) (Cornichon-like protein)
Cleaved into：
GeneID：12794
Gene names (primary )：Cnih2
Gene names (synonym )：Cnil
Gene names (ORF )：
Length：160
Mass：18931
Sequence：MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
Tissue specificity：Brain. Highest levels seen in the hippocampus, intermediate levels in the cerebral cortex, striatum olfactory bulb, and thalamus and lower levels in the cerebellum (at protein level). Also expressed in the lung. {ECO:0000269|PubMed:10022955, ECO:0000269|PubMed:21172611}.
Induction：
Developmental stage：First detected at the eight-cell stage. Expressed in eight-cell embryo, blastocyst, 6.5-day whole embryo, 7.5-day primitive streak, 11.5-day limb bud and in 13.5-day whole embryo. {ECO:0000269|PubMed:10022955}.
Protein families：Cornichon family