LPAL2_HUMAN Q16609
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16609
Recommended name:Putative apolipoprotein(a)-like protein 2
EC number:
Alternative names:(Apo(a)-like protein 2) (Lp(a)-liker protein 2) (Apolipoprotein a-related gene C protein) (Apo(a)rg-C)
Cleaved into:
GeneID:
Gene names (primary ):LPAL2
Gene names (synonym ):APOARGC
Gene names (ORF ):
Length:132
Mass:14886
Sequence:MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPNDGLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA
Tissue specificity:Expressed in liver but not in other tissues tested. {ECO:0000269|PubMed:7749817}.
Induction:
Developmental stage:
Protein families: