GSTM5_RAT   Q9Z1B2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z1B2

Recommended name:Glutathione S-transferase Mu 5

EC number:EC:2.5.1.18

Alternative names:GST class-mu 5

Cleaved into:

GeneID:64352

Gene names  (primary ):Gstm5

Gene names  (synonym ):

Gene names  (ORF ):

Length:225

Mass:26,629

Sequence:MSCSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKQYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYNSNHESLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRMFEPKCLDEFPNLKAFMCRFEALEKIAAFLQSDRCFKMPINNKMAKWGNKSIC

Tissue specificity:Expressed in testis and brain. Very low expression in liver, kidney, heart and lung. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp