LRC29_HUMAN   Q8WV35


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WV35

Recommended name:Leucine-rich repeat-containing protein 29

EC number:

Alternative names:(F-box and leucine-rich repeat protein 9) (F-box protein FBL9) (F-box/LRR-repeat protein 9)

Cleaved into:

GeneID:26231

Gene names  (primary ):LRRC29

Gene names  (synonym ):FBL9 FBXL9

Gene names  (ORF ):

Length:223

Mass:23797

Sequence:MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL

Tissue specificity:Expressed in heart, kidney, liver, lung and pancreas. {ECO:0000269|PubMed:10531037}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp