UBIP1_MOUSE   Q811S7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q811S7

Recommended name:Upstream-binding protein 1

EC number:

Alternative names:(Nuclear factor 2d9) (NF2d9)

Cleaved into:

GeneID:22221

Gene names  (primary ):Ubp1

Gene names  (synonym ):Cp2b Nf2d9

Gene names  (ORF ):

Length:540

Mass:60212

Sequence:MAWVLSMDEVIESGLVHDFDSSLSGIGQELGAGAYSMSDVLALPIFKQEDSSLSLEDEAKHPPFQYVMCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPELSGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKNDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDTPTAYVNNSPSPAPTFTSSQPSTCSVPDSNSSSPNHQGDGAAQASGEQIQPSATTQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCQEQPSSTALQGQPQAAGSGGESGGGTPSVYHAIYLEEMVASEVARKLASVFNIPFHQINQVYRQGPTGIHILVSDQMVQNFQDETCFLFSTVKAENNDGIHIILK

Tissue specificity:Ubiquitous. Highly expressed in erythroid cells. {ECO:0000269|PubMed:15988015, ECO:0000269|PubMed:7623810}.

Induction:

Developmental stage:

Protein families:Grh/CP2 family, CP2 subfamily


   💬 WhatsApp