TREM2_HUMAN Q9NZC2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NZC2
Recommended name:Triggering receptor expressed on myeloid cells 2
EC number:
Alternative names:(TREM-2) (Triggering receptor expressed on monocytes 2)
Cleaved into:
GeneID:54209
Gene names (primary ):TREM2
Gene names (synonym ):
Gene names (ORF ):
Length:230
Mass:25447
Sequence:MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT
Tissue specificity:Expressed in the brain, specifically in microglia and in the fusiform gyrus (at protein level) (PubMed:28802038, PubMed:28855300, PubMed:27477018, PubMed:29752066). Expressed on macrophages and dendritic cells but not on granulocytes or monocytes (PubMed:10799849, PubMed:28855301). In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord (PubMed:12080485). {ECO:0000269|PubMed:10799849, ECO:0000269|PubMed:12080485, ECO:0000269|PubMed:27477018, ECO:0000269|PubMed:28802038, ECO:0000269|PubMed:28855300, ECO:0000269|PubMed:28855301, ECO:0000269|PubMed:29752066}.
Induction:
Developmental stage:
Protein families: