KAD6_HUMAN Q9Y3D8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y3D8
Recommended name:Adenylate kinase isoenzyme 6
EC number:EC:2.7.4.3
Alternative names:(AK6) (Adrenal gland protein AD-004) (Coilin-interacting nuclear ATPase protein) (hCINAP) (Dual activity adenylate kinase/ATPase) (AK/ATPase)
Cleaved into:
GeneID:102157402
Gene names (primary ):AK6
Gene names (synonym ):CINAP
Gene names (ORF ):AD-004 CGI-137
Length:172
Mass:20061
Sequence:MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Tissue specificity:Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, chorionic villi and the central nervous system. {ECO:0000269|PubMed:16079131}.
Induction:
Developmental stage:
Protein families:Adenylate kinase family, AK6 subfamily