PIPNA_HUMAN   Q00169


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00169

Recommended name:Phosphatidylinositol transfer protein alpha isoform

EC number:

Alternative names:(PI-TP-alpha) (PtdIns transfer protein alpha) (PtdInsTP alpha)

Cleaved into:

GeneID:5306

Gene names  (primary ):PITPNA

Gene names  (synonym ):PITPN

Gene names  (ORF ):

Length:270

Mass:31806

Sequence:MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD

Tissue specificity:Expressed in a wide range of tissues.

Induction:

Developmental stage:

Protein families:PtdIns transfer protein family, PI transfer class I subfamily


   💬 WhatsApp