STK11_MOUSE Q9WTK7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTK7
Recommended name：Serine/threonine-protein kinase STK11
EC number：EC 2.7.11.1
Alternative names：(Liver kinase B1 homolog) (LKB1) (mLKB1)
Cleaved into：
GeneID：20869
Gene names (primary )：Stk11
Gene names (synonym )：Lkb1
Gene names (ORF )：
Length：436
Mass：49267
Sequence：MDVADPEPLGLFSEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCGPPLSDLLRGMLEYEPAKRFSIRQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEEEDLFDIEDGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGTANPARKVCSSNKIRRLSACKQQ
Tissue specificity：[Isoform 1]: Widely expressed. {ECO:0000269|PubMed:10642527, ECO:0000269|PubMed:18774945, ECO:0000269|PubMed:18854309}.; [Isoform 2]: Predominantly expressed in testis (at protein level). {ECO:0000269|PubMed:18774945}.; [Isoform 3]: Expressed in adult brain and liver and absent from tissues derived from postnatal day 7. {ECO:0000269|PubMed:29777910}.
Induction：
Developmental stage：Ubiquitously expressed 7-11 dpc. Present in nucleated embryonic blood cells from 9 dpc. Restricted to gastrointestinal tract, testis and lung from days 15-19 dpc. {ECO:0000269|PubMed:10381580, ECO:0000269|PubMed:12060709}.
Protein families：Protein kinase superfamily, CAMK Ser/Thr protein kinase family, LKB1 subfamily