FABP9_MOUSE O08716
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08716
Recommended name：Fatty acid-binding protein 9
EC number：
Alternative names：(15 kDa perforatorial protein) (PERF 15) (Testis lipid-binding protein) (TLBP) (Testis-type fatty acid-binding protein) (T-FABP)
Cleaved into：
GeneID：21884
Gene names (primary )：Fabp9
Gene names (synonym )：Perf15 Tlbp
Gene names (ORF )：
Length：132
Mass：15017
Sequence：MIEPFLGTWKLISSENFENYVRELGVECEPRKVACLIKPSVSISFNGERMDIQAGSACRNTEISFKLGEEFEETTADNRKVKSLITFEGGSMIQVQKWLGKQTTIKRKIVDGKMVVECTMNNVVSTRIYERV
Tissue specificity：Testis.
Induction：
Developmental stage：
Protein families：Calycin superfamily, Fatty-acid binding protein (FABP) family