CLD10_HUMAN P78369
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P78369
Recommended name：Claudin-10
EC number：
Alternative names：(Oligodendrocyte-specific protein-like) (OSP-like)
Cleaved into：
GeneID：9071
Gene names (primary )：CLDN10
Gene names (synonym )：
Gene names (ORF )：
Length：228
Mass：24488
Sequence：MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
Tissue specificity：Expressed in the kidney, eccrine sweat glands and in all layers of the epidermis. In the kidney, it is detected in the thick ascending limb of Henle's loop (TAL) (PubMed:28771254, PubMed:28686597). In the sweat glands, it is expressed in cells from secretory portions, corresponding to the clear cells (PubMed:28686597). {ECO:0000269|PubMed:28686597, ECO:0000269|PubMed:28771254}.
Induction：
Developmental stage：
Protein families：Claudin family