GSTM1_HUMAN   P09488


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09488

Recommended name:Glutathione S-transferase Mu 1

EC number:EC:2.5.1.18

Alternative names:(GST HB subunit 4) (GST class-mu 1) (GSTM1-1) (GSTM1a-1a) (GSTM1b-1b) (GTH4)

Cleaved into:

GeneID:2944

Gene names  (primary ):GSTM1

Gene names  (synonym ):GST1

Gene names  (ORF ):

Length:218

Mass:25712

Sequence:MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK

Tissue specificity:Liver (at protein level). {ECO:0000269|PubMed:7822249}.

Induction:

Developmental stage:

Protein families:GST superfamily, Mu family


   💬 WhatsApp