PSB2_RAT P40307
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P40307
Recommended name：Proteasome subunit beta type-2
EC number：
Alternative names：
Cleaved into：
GeneID：29675
Gene names (primary )：Psmb2
Gene names (synonym )：
Gene names (ORF )：
Length：201
Mass：22,912
Sequence：MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENITFTKRSS
Tissue specificity：Down-regulated by theophylline (THP) and 1,3-dinitrobenzene (DNB), two reprotoxic agents thought to induce infertility. 1
Induction：
Developmental stage：
Protein families：