CRGF_MOUSE   Q9CXV3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CXV3

Recommended name:Gamma-crystallin F

EC number:

Alternative names:(Gamma-F-crystallin)

Cleaved into:

GeneID:12969

Gene names  (primary ):Crygf

Gene names  (synonym ):

Gene names  (ORF ):

Length:174

Mass:21249

Sequence:MGKITFYEDRSFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFAGCQYFLRRGDYPDYQQWMGFSDSVRSCHLIPHSTSHRIRIYEREDYRGQMVEITDDCSHLQDRFHFSDFHSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRIMDFY

Tissue specificity:

Induction:

Developmental stage:In the embryo, expressed by day 12 of gestation. Maximum levels are found at day 30-40 followed by a rapid decline.

Protein families:Beta/gamma-crystallin family


   💬 WhatsApp