ZDH15_RAT Q2TGJ4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2TGJ4
Recommended name：Palmitoyltransferase ZDHHC15 Curated
EC number：EC:2.3.1.225
Alternative names：Acyltransferase ZDHHC15 By Similarity (EC:2.3.1.- By Similarity) . EC:2.3.1.- (UniProtKB | ENZYME | Rhea) By Similarity Zinc finger DHHC domain-containing protein 15 (DHHC-15)
Cleaved into：
GeneID：317235
Gene names (primary )：Zdhhc15
Gene names (synonym )：
Gene names (ORF )：
Length：337
Mass：39,308
Sequence：MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGNGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEEPWEDNEDESQDYPEGLSSLAVESET
Tissue specificity：In brain, expressed in both excitatory and inhibitory neurons but not expressed by glial cells. 1
Induction：
Developmental stage：Highly expressed during early stages of development at 17 dpc and postnatal day 10 (P10) but significantly reduced in the adult brain. 1
Protein families：DHHC palmitoyltransferase family