T4S20_HUMAN Q53R12
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q53R12
Recommended name：Transmembrane 4 L6 family member 20
EC number：
Alternative names：
Cleaved into：
GeneID：79853
Gene names (primary )：TM4SF20
Gene names (synonym )：
Gene names (ORF )：UNQ518/PRO994
Length：229
Mass：25075
Sequence：MTCCEGWTSCNGFSLLVLLLLGVVLNAIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGLMAIPATTMSLTARKRACCNNRTGMFLSSLFSVITVIGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGILEVLFGLSQIVIGFLGCLCGVSKRRSQIV
Tissue specificity：Expressed in the brain, with high levels in the parietal lobe, hippocampus, pons, white matter and cerebellum. {ECO:0000269|PubMed:23810381}.
Induction：TGFB1 inhibits TM4SF20 expression to activate CREB3L1 (PubMed:25310401). {ECO:0000269|PubMed:25310401}.
Developmental stage：
Protein families：L6 tetraspanin family