UCP2_MOUSE   P70406


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70406

Recommended name:Mitochondrial uncoupling protein 2

EC number:

Alternative names:(UCP 2) (Solute carrier family 25 member 8) (UCPH)

Cleaved into:

GeneID:22228

Gene names  (primary ):Ucp2

Gene names  (synonym ):Slc25a8

Gene names  (ORF ):

Length:309

Mass:33374

Sequence:MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYRGVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAAYQSREAPF

Tissue specificity:Highest in white adipose tissue, also detected in brown adipose tissue, heart and kidney. 4-6 times higher levels are detected in ob/ob and db/db mice.

Induction:

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp