B2L11_HUMAN   O43521


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43521

Recommended name:Bcl-2-like protein 11

EC number:

Alternative names:(Bcl2-L-11) (Bcl2-interacting mediator of cell death)

Cleaved into:

GeneID:10018

Gene names  (primary ):BCL2L11

Gene names  (synonym ):BIM

Gene names  (ORF ):

Length:198

Mass:22171

Sequence:MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

Tissue specificity:Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney. {ECO:0000269|PubMed:12019181}.

Induction:By ER stress in a DDIT3/CHOP-dependent manner. {ECO:0000269|PubMed:22761832}.

Developmental stage:

Protein families:Bcl-2 family


   💬 WhatsApp