CALL3_HUMAN P27482
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27482
Recommended name:Calmodulin-like protein 3
EC number:
Alternative names:(CaM-like protein) (CLP) (Calmodulin-related protein NB-1)
Cleaved into:
GeneID:810
Gene names (primary ):CALML3
Gene names (synonym ):
Gene names (ORF ):
Length:149
Mass:16891
Sequence:MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Tissue specificity:Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells. {ECO:0000269|PubMed:2217169}.
Induction:By TGFB1. {ECO:0000269|PubMed:2217169}.
Developmental stage:
Protein families:Calmodulin family