ACKMT_MOUSE   Q9D1Z3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D1Z3

Recommended name:ATP synthase subunit C lysine N-methyltransferase

EC number:EC 2.1.1.-

Alternative names:(Protein N-lysine methyltransferase FAM173B) (mFam173b)

Cleaved into:

GeneID:68073

Gene names  (primary ):Atpsckmt

Gene names  (synonym ):Fam173b

Gene names  (ORF ):

Length:247

Mass:27397

Sequence:MERVGTPEEERQAGPVLPTSLESDSSKRTSWGFLITGVVGGALLTVYAVATPFITPALRKVCLPFVPATSKQVENVVRMLRHRRGPLVDIGSGDGRIVIAAAKEGFPAVGYELNPWLVWYSRYRAWRAGVHGSAKFYISDLWKVTFAQYSNVVIFGVPQMMPQLEKKLELELEDGARVIACRFPFPRWTPDHTTGEGIDTVWAYDMSAQRGRGGRPNQEWVGQKNLSETAGLQASSSETRSKLLDVE

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:29444090}.

Induction:Expression is up-regulated in dorsal root ganglia (DRG) during chronic inflammatory pain. {ECO:0000269|PubMed:29444090}.

Developmental stage:

Protein families:ANT/ATPSC lysine N-methyltransferase family


   💬 WhatsApp