JUPI2_HUMAN Q9H910
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H910
Recommended name：Jupiter microtubule associated homolog 2
EC number：
Alternative names：(Hematological and neurological expressed 1-like protein) (HN1-like protein)
Cleaved into：
GeneID：90861
Gene names (primary )：JPT2
Gene names (synonym )：C16orf34 HN1L
Gene names (ORF )：L11
Length：190
Mass：20063
Sequence：MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY
Tissue specificity：Expressed in liver, kidney, prostate, testis and uterus. {ECO:0000269|PubMed:15094197}.
Induction：Up-regulated in squamous cell carcinoma (SCC) adenocarcinoma (AC), adenosquamous cell carcinoma (ASCC), bronchioalveolar carcinoma (BAC), breast and uterus tumors. {ECO:0000269|PubMed:15334068}.
Developmental stage：
Protein families：JUPITER family